PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 336aa    MW: 38616.3 Da    PI: 6.1104
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490359.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.76.2e-28958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs++++l  +s
  XP_004490359.1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSNRLSHFS 58
                    79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.604161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-29280IPR002100Transcription factor, MADS-box
CDDcd002653.95E-37275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-253859IPR002100Transcription factor, MADS-box
PfamPF014869.0E-6125191IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD IDIALIMFSP SNRLSHFSGK  60
RRIEDVFTRY INLPDQEREN AVSFPELPYR RNIQNKEFLL RTLQQLRSEN DIALHMSNPG  120
DINSEIEELQ QEVSRLQQQL QIAEEQIRMY EPDPLKMTSM AELETSEKNV VETLARVMQR  180
KEILLNNHLS TYDPTGIQGM PTSFENVGWL QDGSQNHSHI FDASAPMDPL RDLSSTVYGS  240
FSQGTSSNVD PRGIGDCHVT NPNDGNLQAW PQGYTLYPPP HHHIQHDMVR TDHHIQDMMP  300
HGQINMPITA SQVEPPKNES AEYDQCKQPN HQLHAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-17270168Myocyte-specific enhancer factor 2A
3mu6_C3e-17270168Myocyte-specific enhancer factor 2A
3mu6_B3e-17270168Myocyte-specific enhancer factor 2A
3mu6_A3e-17270168Myocyte-specific enhancer factor 2A
1tqe_S3e-17180181Myocyte-specific enhancer factor 2B
1tqe_R3e-17180181Myocyte-specific enhancer factor 2B
1tqe_Q3e-17180181Myocyte-specific enhancer factor 2B
1tqe_P3e-17180181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490359.10.0PREDICTED: agamous-like MADS-box protein AGL5
SwissprotQ9LM461e-116AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A072UYG70.0A0A072UYG7_MEDTR; MADS-box transcription factor
STRINGGLYMA14G34160.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85252735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-102AGAMOUS-like 104